Award
 Refer a Friend  Bookmark us  Link To Us  Home
 
Solutions Search! The Customized Life Science Search Engine
Search Site
Search Suppliers
Search Internet
Search over 6000 life science websites specifically selected by our expert scientist moderators.

Other Topics
5/28/2008 09:08 PM
7/2/2008 09:56 AM
9/17/2007 11:36 AM
6/6/2008 11:28 AM
5/8/2008 01:51 PM
4/26/2008 11:54 AM
4/25/2008 02:09 AM
1/19/2008 02:51 PM
10/9/2007 09:48 AM
12/24/2007 07:05 AM
12/18/2007 12:16 AM
12/4/2007 08:26 AM
6/22/2007 06:44 PM
11/5/2007 03:00 PM
10/19/2007 03:12 PM
10/12/2007 07:40 PM
10/10/2007 10:43 AM
10/9/2007 09:34 AM
9/29/2007 11:16 AM
9/27/2007 03:31 PM
9/18/2007 01:35 PM
9/17/2007 04:30 AM
9/13/2007 08:35 PM
8/17/2007 12:24 PM
9/11/2007 03:35 AM
8/29/2007 10:47 AM
8/29/2007 08:30 PM
8/17/2007 08:55 AM
7/19/2007 10:17 AM
6/25/2007 04:18 PM
Subscribet to topic
bottom of page RSS Feed Topic Feed
 protein quantification at 280nms [View Printable]
deepika

Frog Egg

Avatar of deepika
See
Similar
Scientists





Group: Member
Posts: 3
Joined: Oct 19, 2007







 Send a personal messsage to deepika Reply with a quote from this post Go to the top of the page

hello everybody..
i am new to this forum... i need sum help regarding the quantification of protein at 280nms.. can anyone please tell me how to go for it if i want to calculate directly in mg/ml...i have tried several times on net bt am nt getting the right way of calculating....may b i think thr is sum prob wid the calculation formula.. i am trying to find on net bt thr they mentioned extinction coefficient at .1% gives conc of protein in mg/ml... bt wen i am trying it experimentally i am nt getting the same conc of protein with 280nms and bradford expt.. kindly please help...
thanks in advance
Deepika
.........................

Posted Oct 19, 2007, 15:57 PM
TigerShark

Frog Egg

Avatar of TigerShark
See
Similar
Scientists





Group: Member
Posts: 8
Joined: Sep 11, 2007







 Send a personal messsage to TigerShark Reply with a quote from this post Go to the top of the page

Determine the extinction coefficient of the peptide, for example a prion protein shown below, by pasting in the sequence:
(MKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGTWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHNQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPMMHFGNDWEDRYYRENMNRYPNQVYYRPVDQYNNQNNFVHDCVNITIKQHTVTTTTKGENFTETDIKIMERVVEQMCTTQYQKESQAYYDGRRSS )

at a website like http://us.expasy.org/tools/protparam.html

The website will give pertinent information like #amino acids = 211, mw = 23,191.5g/mol, pI 9.58 etc.... It also gives the calculated extinction coefficient (E) at 61,880M-1cm-1. When the extinction coefficient is divided by the mw, it gives 2.668 (g/L)-1.

With this information, we can calculate the protein concentration. Abs280/2.668 x dilution factor = mg/mL.

The extinction coefficient varies for each protein, so paste in your particular sequence into the webpage.
.........................

Posted Oct 25, 2007, 15:45 PM
deepika

Frog Egg

Avatar of deepika
See
Similar
Scientists





Group: Member
Posts: 3
Joined: Oct 19, 2007







 Send a personal messsage to deepika Reply with a quote from this post Go to the top of the page

Abs280/2.668 x dilution factor = mg/mL.
.........................

Posted Oct 25, 2007, 16:27 PM
deepika

Frog Egg

Avatar of deepika
See
Similar
Scientists





Group: Member
Posts: 3
Joined: Oct 19, 2007







 Send a personal messsage to deepika Reply with a quote from this post Go to the top of the page

hi thanx for ur repy bt i still hav one doubt ... u mentioned that extinction coefficient is divided by the mw, it gives 2.668 (g/L)-1. my ques is how can we can calculate the protein concentration. Abs280/2.668 x dilution factor in mg/mL. wen extinc coeff is in g/L..
anyways thanx 4 ur reply..
Deepika



.........................

Posted Oct 25, 2007, 16:30 PM